Kub.nl Web Analysis and Statistics

Website Summary

  • When was the website Kub.nl released?

    Kub.nl was registered on June 26, 1986 (37 years 10 months 29 days ago).

  • What IP addresses does Kub.nl resolve to?

    Kub.nl resolves to the IP addresses 137.56.209.21

  • Where is Kub.nl server located?

    Kub.nl's server is located in Noord-brabant, Tilburg, Netherlands, 5049.

Kub.nl's metrics:

Global traffic rank:
N/A
Owner info:
Katholieke Universiteit Brabant
Website category:
Education/Reference
Safety status:
Safe

HTML Analysis

HTML Meta tags:

Title: Alumni | Tilburg University

Description: Welkom in jouw alumninetwerk met meer dan 80.000 leden, zowel nationaal als internationaal. Wanneer je afstudeert, word je automatisch onderdeel van dit netwerk. Zo blijf je altijd betrokken bij je Alma mater. Tilburg University heeft jou namelijk ook na het afstuderen van alles te bieden. Ook kun jij nog veel betekenen voor jouw mede alumni en de universiteit. Je hoeft er alleen maar voor te zorgen dat we contact met je kunnen opnemen.

Logo: kub.nl

HTML elements:

H1 Headings:
1
H2 Headings:
7
H3 Headings:
11
H4 Headings:
0
H5 Headings:
0
H6 Headings:
0
Total Images:
5
Total IFRAMEs:
1

Links analysis:

Total links:
66
Internal links:
26
Internal links (nofollow):
0
External links:
19
External links (nofollow):
0

HTTP Header:

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sun, 19 Feb 2023 01:04:42 GMT
server: Apache
cache-control: max-age=86400, public
x-drupal-dynamic-cache: UNCACHEABLE
x-ua-compatible: IE=edge
content-language: nl
x-content-type-options: nosniff
x-frame-options: SAMEORIGIN
permissions-policy: interest-cohort=()
expires: Sun, 19 Nov 1978 05:00:00 GMT
vary: Cookie,Accept-Encoding
x-generator: Drupal 9 (https://www.drupal.org)
x-drupal-cache: HIT
last-modified: Sun, 19 Feb 2023 01:04:41 GMT
etag: "1676768681-gzip"
content-encoding: gzip
content-length: 9529
content-type: text/html; charset=UTF-8
strict-transport-security: max-age=31556952; includeSubDomains; preload;

Kub.nl SSL Certificate Information

kub.nl supports HTTPS with the following certificate information:

Common name: tilburguniversity.edu
SANs: tilburguniversity.edu, academischewerkplaatsgeestdrift.nl, adp.tias.edu, antonphilipsfund.org, bamatrix.nl, banneker.uvt.nl, bouchet.uvt.nl, brabantcollectie.nl, bscdatascience.com, bscdatascience.nl, canvas.beta.uvt.nl, canvas.test.uvt.nl, canvas.uvt.nl, caseonline.nl, center.nl, center.uvt.nl, cert.uvt.nl, codebrabant.nl, collectieveacties.nl, commissielevelt.nl, cyberdam.org, datasciencebachelor.com, datasciencebachelor.nl, datasciencebsc.com, datasciencebsc.nl, datasciencecluster.com, datasciencecluster.nl, datasciencehub.nl, datasciencemaster.nl, datasciencemasters.nl, datasciencemsc.com, datasciencemsc.nl, datasciencenl.com, datasciencenl.nl, datascienceshub.com, datascienceshub.nl, datasciencesmasters.nl, dekinderuniversiteit.nl, econometricsandor.nl, econtrack.nl, edcnl.nl, eriss.eu, eriss.nl, eriss.org, europeanpensiondebate.com, europeanpensiondebate.eu, europeantaxcollege.com, faculteit-katholieke-theologie.nl, filmenfotobank-nb.nl, fiscaalinstituut.nl, fkt.nl, fotobankmartiencoppens.nl, gve.uvt.nl, historyofinternationallaw.org, hubspot.tias.edu, innovationandgrowth.org, intervict.com, intervict.nl, ithelp.tias.edu, jetoekomstkiezen.nl, jouwtoekomst-jouwkeuze.nl, jouwtoekomstjouwkeuze.nl, juricam.nl, katholieke-theologie-nederland.nl, katholieke-theologische-faculteit-nederland.nl, kinderuniversiteitbrabant.nl, kinderuniversiteittilburgeindhoven.nl, kub.nl, kwartaalschrifteconomie.nl, learningtomakeadifference.nl, learningtomakethedifference.nl, learntomakeadifference.nl, learntomakethedifference.nl, medicalpsychology.nl, medischepsychologie.nl, metrechtdebeste.nl, mgsde.com, mgsde.nl, mscdatascience.com, mscdatascience.nl, nachtuniversiteit.nl, neverstopasking.com, neverstopasking.nl, nightuniversity.nl, poule.uvt.nl, pronunciation.uvt.nl, realestatelab.nl, rechtenonline.com, rechtenonline.net, rechtenonline.org, rechtinbeeld.com, redirect.uvt.nl, schoolforbusinessandsociety.com, schoolforbusinessandsociety.net, schoolforbusinessandsociety.nl, schoolforbusinessandsociety.org, selfserviceportal.uvt.nl, ssp.uvt.nl, startasking.nl, startdoing.nl, strooischade.nl, study-in-holland.nl, theologie-in-nederland.nl, theologie-studeren.nl, tias-nimbas.nl, tias.nl, tias8hr.com, tias8hr.nl, tiasnimbas.nl, ticer.nl, tilburgsummerschool.nl, tilburgu.com, tilburgu.eu, tilburgu.net, tilburgu.nl, tilburgu.nu, tilburgu.org, tilburguniversity-exed.com, tilburguniversity.be, tilburguniversity.cn, tilburguniversity.com, tilburguniversity.eu, tilburguniversity.nl, tilburguniversity.pl, tilburguniversityjunior.nl, tilt.nl, tranzo.nl, tranzo.org, trucmetjam.nl, type-d.nl, type-d.org, typed.nl, uctilburg.com, uctilburg.nl, uitspraak.uvt.nl, understandingsociety.com, understandingsociety.nl, universiteittilburg.nl, universiteitvantilburg.nl, universitycollegetilburg.com, universitycollegetilburg.nl, uvt.eu, uvt.nl, vastgoedlab.nl, victimology.nl, vriendenvancobbenhagen.nl, waarstajij.uvt.nl, webmail.tias.edu, werkenbijtias.nl, wiki.tilburguniversity.edu, wikieng.tilburguniversity.edu, wikinl.tilburguniversity.edu, wintercourse.com, workforce.tias.edu
Organization: Tilburg University
Location: Noord-Brabant, NL
Serial Number: 1F2B841FAAA505E5153A6F2EF0842083
Signature Algorithm: RSA-SHA384
Issuer: GEANT OV RSA CA 4
Fingerprint: 0940a61b8b88bde5114bafb71bf531eab84b22a0
FingerprintSha256: 5bb88e08f58f075c578f22205eafc52ae8b470ee89d0775af207f965f9d7c71f

Kub.nl Domain Name Information

Domain TLD:
nl
Registration Date:
June 26, 1986
Domain Age:
37 years 10 months 29 days
Domain Status:
active

Domain Nameserver Information:

Host IP Address Country
ns1.uvt.nl 137.56.247.39 🇳🇱 Netherlands
ns2.uvt.nl 137.56.247.40 🇳🇱 Netherlands

Full WHOIS Lookup:

Domain name: kub.nl
Status: active

Registrar:
Katholieke Universiteit Brabant
Warandelaan 2
5037AB Tilburg
Netherlands

Abuse Contact:

Creation Date: 1986-06-26

Updated Date: 2022-04-29

DNSSEC: yes

Domain nameservers:
ns1.uvt.nl
ns2.uvt.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Kub.nl Server Information

Server IP Address:
137.56.209.21
Hosted Country:
🇳🇱 Netherlands
Latitude, longitude:
51.5555 , 5.0913
Location:
Noord-brabant, Tilburg, Netherlands, 5049

DNS Record Analysis:

Host Type TTL Extra
kub.nl A 300 IP: 137.56.209.21
kub.nl A 300 IP: 137.56.209.22
kub.nl NS 3600 Target: ns1.uvt.nl
kub.nl NS 3600 Target: ns2.uvt.nl
kub.nl SOA 3600 MNAME: ns1.uvt.nl
RNAME: hostmaster.uvt.nl
Serial: 2023021902
Refresh: 28800
Retry: 14400
Expire: 604800
Minimum TTL: 300
kub.nl MX 3600 Priority: 10
Target: a.mx.prdtnnng.uvt.nl
kub.nl MX 3600 Priority: 10
Target: b.mx.prdtnnng.uvt.nl
kub.nl TXT 3600 TXT: Tilburg University
kub.nl TXT 3600 TXT: Warandelaan 2, Tilburg, The Netherlands
kub.nl TXT 3600 TXT: P.O.box 90153, 5000 LE Tilburg, The Netherlands
kub.nl TXT 3600 TXT: phone: +31-13-4669111
kub.nl TXT 3600 TXT: v=spf1 include:_spfcampus.uvt.nl -all
kub.nl TXT 3600 TXT: Universiteit van Tilburg
kub.nl AAAA 300 IPV6: 2001:610:1410:280:24ee:f0cd:bb36:7745
kub.nl AAAA 300 IPV6: 2001:610:1410:280:24ee:f0cd:6282:7639
kub.nl CAA 3600 Flags: 0
kub.nl CAA 3600 Flags: 0
kub.nl CAA 3600 Flags: 0

Typos of Kub.nl

Sometimes, misspellings make a good domain name. And spelling errors are also a great way to create keywords for SEO. And the following are all possible typos of Kub.nl. You can use them for competitive domain name search or for SEO strategies for Kub.nl:

  1. jub.nl
  2. mub.nl
  3. lub.nl
  4. oub.nl
  5. iub.nl
  6. kyb.nl
  7. khb.nl
  8. kjb.nl
  9. kib.nl
  10. k8b.nl
  11. k7b.nl
  12. kuv.nl
  13. kun.nl
  14. kuh.nl
  15. kug.nl
  16. ub.nl
  17. kb.nl
  18. ku.nl
  19. ukb.nl
  20. kbu.nl
  21. kkub.nl
  22. kuub.nl
  23. kubb.nl

Thank you for reading our analysis & statistics about Kub.nl website. If you find it interesting, please share it with your friends. If you have any suggestions, please comment below or contact us.

Let's share 💋💋💋